You can buy experimental Laser system for experiments in Wave Genetics and Torsion fields. Creation on their basis of individual meditative musical programs. We also translate into the melody the sequenced sections of genes, thereby producing Music of DNA.
I am glad to welcome everyone.I got a rather interesting idea of using my laser setup.And so here is a spinor spectrometer created in our laboratory for biological experiments.How does he work.The laser beam scanning any biomacromalecules contains information related to the dynamic polarization modulation of two orthogonal optical modes of laser radiation.This approach could …
I propose an open experiment on plants, non-invasive intervention in the genomic structures of plants by means of exposure to (mBER) Modulated broadband electromagnetic radiation by the HE-NE laser secondary radiation field. We have obtained a file of the (mBER) spectrum of the secondary laser radiation modulated by the polarization of the laser beam of …
Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.
Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.
Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.
Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.
Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.
Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.
Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.
Dna Music – How the Human GJB2 Gene Sings (translation mRNA)—————————–Translation into a melody from amino acid assembly sequences.The melody of the translation (assembly) of amino acids (proteins) from the mRNA template region of the human GJB2 gene—————————–Homo sapiens gap junction protein beta 2 (GJB2), mRNA/ gene = ”GJB2 ″/ Translation = “MDWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVW GDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEK KRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDG …