Blog

You can buy experimental Laser system for experiments in Wave Genetics and Torsion fields. Creation on their basis of individual meditative musical programs. We also translate into the melody the sequenced sections of genes, thereby producing Music of DNA.

Generation Bitcoin wallet on quantum states 1

Generation Bitcoin wallet on quantum states

I am glad to welcome everyone.I got a rather interesting idea of ​​using my laser setup.And so here is a spinor spectrometer created in our laboratory for biological experiments.How does he work.The laser beam scanning any biomacromalecules contains information related to the dynamic polarization modulation of two orthogonal optical modes of laser radiation.This approach could …

Quantum biology experiments Non-invasive intervention in plant genomic structures 3

Quantum biology experiments Non-invasive intervention in plant genomic structures

I propose an open experiment on plants, non-invasive intervention in the genomic structures of plants by means of exposure to (mBER) Modulated broadband electromagnetic radiation by the HE-NE laser secondary radiation field. We have obtained a file of the (mBER) spectrum of the secondary laser radiation modulated by the polarization of the laser beam of …

Music of Painting - Floating Islands in the Sky 5

Music of Painting – Floating Islands in the Sky

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

How the picture sounds - Adele Angel Daniel B Holeman 7

How the picture sounds – Adele Angel Daniel B Holeman

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

meditation omtec - Subtle world noosphere of the planet 9

meditation omtec – Subtle world noosphere of the planet

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

Translation of a picture to music - Olga Sheveleva 11

Translation of a picture to music – Olga Sheveleva

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

How the image sounds - Veil Nebula 13

How the image sounds – Veil Nebula

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

Music from the Pleiades image 15

Music from the Pleiades image

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

How the picture sings subtle worlds 17

How the picture sings subtle worlds

Hi friends, I create personal meditation audio-visual programs based on your image. I use a unique method of converting images to music.

Dna Music - How the Human GJB2 Gene Sings (translation mRNA) 19

Dna Music – How the Human GJB2 Gene Sings (translation mRNA)

Dna Music – How the Human GJB2 Gene Sings (translation mRNA)—————————–Translation into a melody from amino acid assembly sequences.The melody of the translation (assembly) of amino acids (proteins) from the mRNA template region of the human GJB2 gene—————————–Homo sapiens gap junction protein beta 2 (GJB2), mRNA/ gene = ”GJB2 ″/ Translation = “MDWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVW GDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRHEK KRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDG …